CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner
Home > Product > Heterocyclic Organic Compounds > Gastrin releasing peptide,porcine

Gastrin releasing peptide,porcine | CAS Number: 74815-57-9

Catalog Number
ACM74815579
Product Name
Gastrin releasing peptide,porcine
Structure
CAS Number
74815-57-9
Synonyms
GASTRIN RELEASING PEPTIDE, PORCINE;GRP (PORCINE);H-ALA-PRO-VAL-SER-VAL-GLY-GLY-GLY-THR-VAL-LEU-ALA-LYS-MET-TYR-PRO-ARG-GLY-ASN-HIS-TRP-ALA-VAL-GLY-HIS-LEU-MET-NH2;APVSVGGGTVLAKMYPRGNHWAVGHLM-NH2;ALA-PRO-VAL-SER-VAL-GLY-GLY-GLY-THR-VAL-LEU-ALA-LYS-MET-TYR
Molecular Weight
2805.29
Molecular Formula
C126H198N38O31S2
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA