CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner
Home > Product > Heterocyclic Organic Compounds > H-Ser-arg-thr-his-arg-his-ser-met-glu-ile-arg-thr-pro-asp-ile-asn-pro-ala-trp-tyr-ala-ser-arg-gly-ile-arg-pro-val-gly-arg-phe-nh2

H-Ser-arg-thr-his-arg-his-ser-met-glu-ile-arg-thr-pro-asp-ile-asn-pro-ala-trp-tyr-ala-ser-arg-gly-ile-arg-pro-val-gly-arg-phe-nh2 | CAS Number: 235433-36-0

Catalog Number
ACM235433360
Product Name
H-Ser-arg-thr-his-arg-his-ser-met-glu-ile-arg-thr-pro-asp-ile-asn-pro-ala-trp-tyr-ala-ser-arg-gly-ile-arg-pro-val-gly-arg-phe-nh2
Structure
CAS Number
235433-36-0
Synonyms
PRRP31;PRRP31 (HUMAN);PRRP20;PRRP20 (HUMAN);SER-ARG-THR-HIS-ARG-HIS-SER-MET-GLU-ILE-ARG-THR-PRO-ASP-ILE-ASN-PRO-ALA-TRP-TYR-ALA-SER-ARG-GLY-ILE-ARG-PRO-VAL-GLY-ARG-PHE-NH2;SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2;PROLACTIN-RELEASING PEPTIDE (HUMAN);PROLACTIN-
Molecular Weight
2272.57
Molecular Formula
C104H158N32O26
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA