CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner
Home > Product > Heterocyclic Organic Compounds > (Pyr11)-amyloid beta-protein(11-40)

(Pyr11)-amyloid beta-protein(11-40) | CAS Number: 192377-94-9

Catalog Number
ACM192377949
Product Name
(Pyr11)-amyloid beta-protein(11-40)
Structure
CAS Number
192377-94-9
Synonyms
PYR-VHHQKLVFFAEDVGSNKGAIIGLMVGGVV;PYR-VAL-HIS-HIS-GLN-LYS-LEU-VAL-PHE-PHE-ALA-GLU-ASP-VAL-GLY-SER-ASN-LYS-GLY-ALA-ILE-ILE-GLY-LEU-MET-VAL-GLY-GLY-VAL-VAL-OH;(PYR11)-AMYLOID BETA-PROTEIN (11-40);[PYR11]-BETA-AMYLOID (11-40)
Molecular Weight
3133.62
Molecular Formula
C143H226N38O39S
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA