CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner

Amylin(8-37)(rat) | CAS Number: 138398-61-5

Catalog Number
ACM138398615
Product Name
Amylin(8-37)(rat)
Structure
CAS Number
138398-61-5
IUPAC Name
AMYLIN (8-37) (RAT)
Synonyms
AMYLIN (8-37) (RAT);ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;H-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2;diabetes associated peptide amide*fragment 8-37 R
Molecular Weight
3200.60
Exact Mass
3198.69000
Molecular Formula
C140H227N43O43
Purity
96%
SMILES
CC(C)CC(C(=O)NC(C)C(=O)NC(CC(=O)N)C(=O)NC(CC1=CC=CC=C1)C(=O)NC(CC(C)C)C(=O)NC(C(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CO)C(=O)NC(CO)C(=O)NC(CC(=O)N)C(=O)NC(CC(=O)N)C(=O)NC(CC(C)C)C(=O)NCC(=O)N2CCCC2C(=O)NC(C(C)C)C(=O)NC(CC(C)C)C(=O)N3CCCC3C(=O)N4CCCC4C(=O)NC(C(C)O)C(=O)NC(CC(=O)N)C(=O)NC(C(C)C)C(=O)NCC(=O)NC(CO)C(=O)NC(CC(=O)N)C(=O)NC(C(C)O)C(=O)NC(CC5=CC=C(C=C5)O)C(=O)N)NC(=O)C(CCCNC(=N)N)NC(=O)C(CCC(=O)N)NC(=O)C(C(C)O)NC(=O)C(C)N
InChIKey
KXIRMGRGEHRNNC-ANJGTFPLSA-N
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA