CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner
Home > Product > Heterocyclic Organic Compounds > Protein kinase c(530-558)

Protein kinase c(530-558) | CAS Number: 122613-29-0

Catalog Number
ACM122613290
Product Name
Protein kinase c(530-558)
Structure
CAS Number
122613-29-0
Synonyms
PKC (530-558);PKC FRAGMENT (530-558);PROTEIN KINASE C (530-558);PROTEIN KINASE C FRAGMENT 530-558;LLYEMLAGQAPFEGEDEDELFQSIMEHNV;LLYEMLAGQAPFEGEDEDELFQSIMEHNV-NH2;H-LEU-LEU-TYR-GLU-MET-LEU-ALA-GLY-GLN-ALA-PRO-PHE-GLU-GLY-GLU-ASP-GLU-ASP-GLU-LEU-PHE-GLN-SE
Molecular Weight
3354.67
Molecular Formula
C148H221N35O50S2
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA