CONTACT US

Email: info@alfa-chemistry.com
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA

For product inquiries, please use our online system or send an email to
inquiry@alfa-chemistry.com

chemistry partner
Home > Product > Heterocyclic Organic Compounds > Fibronectin-binding protein peptide d3

Fibronectin-binding protein peptide d3 | CAS Number: 119977-20-7

Catalog Number
ACM119977207
Product Name
Fibronectin-binding protein peptide d3
CAS Number
119977-20-7
Synonyms
FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV;FIBRONECTIN-BINDING PROTEIN;FIBRONECTIN BINDING PROTEIN PEPTIDE;FIBRONECTIN-BINDING PROTEIN PEPTIDE D3;H-PHE-ASN-LYS-HIS-THR-GLU-ILE-ILE-GLU-GLU-ASP-THR-ASN-LYS-ASP-LYS-PRO-SER-TYR-GLN-PHE-GLY-GLY-HIS-ASN-SER-VAL-ASP
Molecular Formula
C190H283N49O66
If you have any other questions or need other size, please get a quote.
  • CAS
  • Size
  • Purity
  • Price
  • Availability
  • Quantity
  • Order

Share

Interested in our Services & Products ? Need detailed information?
facebook twitter linkedin google+

Contact us

Email:
Tel:1-201-478-8534
1-516-662-5404
Fax: 1-516-927-0118
Address: Suite 212, Waverly Plaza, 755 Waverly Avenue, Holtsville, NY 11742, USA